Gene: Cre03.g205900
General Information
Structural Information
- Species Chlamydomonas reinhardtii
- Gene Identifier Cre03.g205900
- Transcript Identifier Cre03.g205900.t1.2
- Gene Type Coding gene
- Location chromosome_3 : 7431230-7432622 : negative
Gene Family Information
- ID HOM05D000821
- #Genes/#Species 724/98
- Phylogenetic origin
- ID ORTHO05D000931
- #Genes/#Species 547/98
- Phylogenetic origin
Gene Duplication Information
Labels
Identifiers
- id Cre03.g205900.v5.5
- pacid 30787393
- alias g4193.t1
- geneName DCA1
- uniprot Q5K1Y0
Descriptions
- Description S-adenosylmethionine decarboxylase
- Description Produces decarboxylated S-adoMet for the first step of polyamine biosynthesis; translationally regulated by a negatively acting uORF MPAVKRTSMRSVYDPIATEPIVASEPARLVVKRTACFADTGSLPS which is regulated in turn by an overlapping tiny ORF MSRPQDASC [PMID: 16176
- Loading (ortholog descriptions from ath)...
Functional Annotation
Biological Process
GO term | Evidence(s) | Provider(s) | Description | Source(s) |
---|---|---|---|---|
GO:0008295 | IBA IEA | GOA Database | spermidine biosynthetic process | |
GO:0008295 | IEA | InterPro | spermidine biosynthetic process | |
GO:0019079 | ISO | PLAZA Integrative Orthology | viral genome replication | AT3G02470 |
GO:0099402 | ISO | PLAZA Integrative Orthology | plant organ development | AT5G18930 |
GO:0016458 | ISO | PLAZA Integrative Orthology | gene silencing | AT3G02470 |
GO:0006597 | IBA IEA | GOA Database | spermine biosynthetic process | |
GO:0006597 | IEA | InterPro | spermine biosynthetic process | |
GO:0006557 | IEA | GOA Database | S-adenosylmethioninamine biosynthetic process | |
GO:0006596 | IEA | GOA Database | polyamine biosynthetic process |
Molecular Function
GO term | Evidence(s) | Provider(s) | Description | Source(s) |
---|---|---|---|---|
GO:0005515 | ISO | PLAZA Integrative Orthology | protein binding | AT5G18930 |
GO:0004014 | IBA IEA | GOA Database | adenosylmethionine decarboxylase activity | |
GO:0004014 | IEA | InterPro | adenosylmethionine decarboxylase activity | |
GO:0016829 | IEA | GOA Database | lyase activity | |
GO:0016831 | IEA | GOA Database | carboxy-lyase activity |
Cellular Component
GO term | Evidence(s) | Provider(s) | Description | Source(s) |
---|---|---|---|---|
GO:0005829 | IBA | GOA Database | cytosol |
Color Legend
Experimental Evidence |
Computational Reviewed Evidence |
Electronic Evidence |
Mapman id | Description |
---|---|
8.2.1 | Polyamine metabolism.spermidine biosynthesis.S-adenosyl methionine decarboxylase |